Bioinformatica Opdracht Retinitis Pigmentosa

Retinitis Pigmentosa




Retinitis Pigmentosa (RP) is een aandoening van de ogen waarbij de staafjes (de cellen in de ogen die contrast weergeven) beschadigd zijn. RP is eigenlijk niet één ziekte maar een verzamelnaam voor een groep erfelijke ziekten van het netvlies die gekenmerkt worden door slecht zien in het donker (nachtblindheid) en zeer geleidelijke beperkingen van het gezichtsveld, die uiteindelijk leidt tot kokerzien.

In de familie de Ruyter komt nachtblindheid veel voor en de geneticus dr. van Steveninck is een onderzoek gestart naar de oorzaak van deze ziekte. Hij heeft ontdekt dat het gaat om een autosomaal dominante aandoening (wil je meer weten over erfelijkheid, zie dan de weblink onder aan deze pagina). Hij heeft een stuk op chromosoom 3 van de patiënten geïsoleerd dat verschilt van gezonde mensen. Hierop ligt het gen voor het rhodopsine eiwit, een eiwit dat betrokken is bij het proces van zien in schemerlicht.

Hopelijk kan kennis over dit eiwit leiden tot het antwoord op de vraag hoe nachtblindheid ontstaat (en wie weet ook de weg openen naar een te ontwikkelen medicijn).

HET ONDERZOEK

Van de familieleden van de familie de Ruyter die aan de ziekte lijden is de DNA volgorde van het rhodopsinegen bepaald. Het blijkt dat er veranderingen (mutaties) in hun rhodopsine zitten.

STAP 1: Het rhodopsinegen

De DNA-volgorde (de sequentie) voor het humane rhodopsine in gezonde mensen is:

atgaatggca cagaaggccc taacttctac gtgcccttct ccaatgcgac gggtgtggta 60

cgcagcccct tcgagtaccc acagtactac ctggctgagc catggcagtt ctccatgctg 120

gccgcctaca tgtttctgct gatcgtgctg ggcttcccca tcaacttcct cacgctctac 180

gtcaccgtcc agcacaagaa gctgcgcacg cctctcaact acatcctgct caacctagcc 240

gtggctgacc tcttcatggt cctaggtggc ttcaccagca ccctctacac ctctctgcat 300

ggatacttcg tcttcgggcc cacaggatgc aatttggagg gcttctttgc caccctgggc 360

ggtgaaattg ccctgtggtc cttggtggtc ctggccatcg agcggtacgt ggtggtgtgt 420

aagcccatga gcaacttccg cttcggggag aaccatgcca tcatgggcgt tgccttcacc 480

tgggtcatgg cgctggcctg cgccgcaccc ccactcgccg gctggtccag gtacatcccc 540

gagggcctgc agtgctcgtg tggaatcgac tactacacgc tcaagccgga ggtcaacaac 600

gagtcttttg tcatctacat gttcgtggtc cacttcacca tccccatgat tatcatcttt 660

ttctgctatg ggcagctcgt cttcaccgtc aaggaggccg ctgcccagca gcaggagtca 720

gccaccacac agaaggcaga gaaggaggtc acccgcatgg tcatcatcat ggtcatcgct 780

ttcctgatct gctgggtgcc ctacgccagc gtggcattct acatcttcac ccaccagggc 840

tccaacttcg gtcccatctt catgaccatc ccagcgttct ttgccaagag cgccgccatc 900

tacaaccctg tcatctatat catgatgaac aagcagttcc ggaactgcat gctcaccacc 960

atctgctgcg gcaagaaccc actgggtgac gatgaggcct ctgctaccgt gtccaagacg 1020

gagacgagcc aggtggcccc ggcctaa 1047

Noot: Hierboven is alleen dat stuk van het DNA gegeven dat codeert voor rhodopsine, van startcodon (ATG) tot stopcodon (TAA). Bedenk dat in werkelijkheid het gen bestaat uit exonen (stukken DNA die coderen voor eiwit) en intronen (stukken DNA die niet coderen voor eiwit) en dat er vaak ook aan de "voorkant" (5' kant) en "achterkant" (3' kant) nog DNA zit dat n iet vertaald wordt tot eiwit. Het complete humane rhodopsine gen is 6953 basen lang.

STAP 2: Het rhodopsine eiwit

De DNA sequentie uit Stap 1 kan met behulp van de codontabel vertaald worden naar een eiwit van 348 aminozuren.

Noot: Aminozuurvolgordes zijn vaak weergegeven in de 1-letternotatie voor de aminozuren. (Wil je ook de structuren van de aminozuren bekijken ga dan naar de webpagina die genoemd staat onderaan deze pagina).

Vragen:
  1. Bekijk de codontabel. Welke codons koderen voor Serine?
  2. Wat is de aminozuurvolgorde van rhodopsine? Doe de eerste 10 aminozuren "met de hand". Gebruik daarna het programma dat je vindt op http://www.expasy.ch/tools/dna.html. Dit programma vertaalt een DNA volgorde in een aminozuur volgorde. Knip en plak bovenstaande DNA sequentie (van startcodon t/m stopcodon) in het venster (met ctrl-c en ctrl-v) en doe de vertaling door op "TRANSLATE SEQUENCE" te drukken.
    Speel wat met het programma. Begrijp je waarom er 6 mogelijke vertalingen gegeven worden ("reading frames")?
    Ook de eiwitsequentie die er uit komt kun je met behulp van knip- en plak werk weer naar je eigen PC halen. Vind je dit te lastig: De sequentie staat ook al afgedrukt in je opdrachtenboek.



STAP 3: Mutaties in humaan rhodopsine

Mutaties in eiwitten ontstaan doordat op DNA-nivo een of meerdere basen veranderen (of verdwijnen). Hierdoor verandert het codon (base-triplet) waar deze base in voorkomt en codeert het codon voor een ander aminozuur.

Een van de mutaties die dr. van Steveninck heeft gevonden bij de RP patienten is:

Lysine 296 => Glutaminezuur (ofwel Lys296Glu, ofwel K296E).

Dit betekent dat op positie 296 bij gezonde mensen een Lysine zit en bij RP patienten een Glutaminezuur.

Vragen:

  1. Wat zijn de codons voor Lysine en voor Glutaminezuur (zie codontabel)?
  2. Welke base is in rhodopsine veranderd (gemuteerd) om de aminozuurverandering K296E te veroorzaken?

Enkele andere mutaties in rhodopsine die RP veroorzaken zijn:


  1. Vertaal de andere aminozuur mutaties die RP kunnen veroorzaken van 3-letternotatie naar 1-letternotatie.
  2. Omcirkel in de sequentie van het rhodopsineeiwit van STAP 2 de bovengenoemde mutatieplaatsen.
Er zijn nog veel meer mutaties van rhodopsine bekend. Uiteraard zijn al deze data opgenomen in databases die je via het Internet kunt vinden. Probeer bijvoorbeeld maar eens met Google (www.google.com) te zoeken op mutants rhodopsin . Je zult dan een aantal websites vinden met overzichten van mutanten van rhodopsine genen gekoppeld aan ziektebeelden.


  1. Probeer met bovenstaande taktiek zo'n database te vinden op het Internet.
    (mocht dit niet lukken kijk dan onderaan deze pagina voor een hyperlink).
  2. Zoek in deze database enkele andere mutaties op in rhodopsine die ook RP veroorzaken. Bedenk hierbij dat rhodopsine vaak met RHO afgekort wordt in de database en dat ADRP (of adRP) staat voor de autosomaal dominante vorm van RP.

STAP 4: De drie-dimensionale structuur van runder rhodopsine

Rhodopsine is een eiwit dat behoort tot de zogenaamde GPCR eiwitten. Deze zitten in de celmembranen van bijna alle cellen en zijn betrokken bij de overdracht van signalen van buiten de cel naar binnen de cel (Lees meer over GPCR eiwitten in de weblinks die onder aan deze pagina zijn gegeven.).

In 2000 is de 3D-structuur van runder rhodopsine bepaald. Hieronder zie je het rhodopsine molecuul.

Je kunt de structuur draaien door de linker-muisknop ingedrukt te houden.
Inzoomen gaat met shift-linkermuis knop en schuiven (transleren) met ctrl-rechtermuis knop.
Als je met je linkermuisknop op een atom klikt verschijnt onder in de balk de naam en het nummer van het atoom.

Zo'n eiwit is op verschillende manieren weer te geven. Zo op het oog is er in dit stokjes-model weinig structuur te ontdekken.
Dat wordt niet veel beter als we er een ruimtevullend model van maken: (klik met linker muisknop).
Maar toch: als je naar de kleuren kijkt zie je dat er aan de uiteinden meer rood (zuurstofatomen) en blauw (stikstof) zit, en dat het midden overwegend grijs (koolstof) is.


Als we door de eiwit-keten een lint tekenen, zodat we het verloop ervan kunnen volgen, verschijnen er krullen, de helix-structuren worden zichtbaar Zij vormen een kanaal door de membraan.

Het plaatje wordt nog overzichtelijker als we alleen het lint tekenen en de atomen weglaten. De helices kunnen we een kleurtje geven:

We hebben dus drie geheel verschillende voorstellingen, modellen, van hetzelfde eiwit gezien, die elk verschillende informatie te zien gaven.

Verdere structuurdetails

Het begin van de rhodopsineketen (aminozuren 1 t/m 20) is weergegeven in blauw en bevindt zich aan de extracellulaire kant van de membraan. Het eind van de rhodopsineketen (aminozuren 328 t/m 348) is weergegeven in geel en bevindt zich aan de cytoplasmatische kant.

Het retinal in het eiwit absorbeert een foton waarna er een conformatieverandering in het eiwit plaatsvindt.

De retinal (groen) is gebonden aan het aminozuur lysine met nummer 296 in rhodopsine (paars)

red/cyan stereo aan uit

Terug naar startstructuur!

 

 

Vragen

  1. Dit molecuul steekt door de celmembraan. Hoe zit het in het membraan denk je?
  2. Hoeveel helixen zijn er eigenlijk?
  3. Wat zouden de gele atomen zijn die je in het ruimtevullend model ziet?
    Weet je ook in welke van de 20 aminozuren deze atomen voorkomen?
    Hint: Welke elementen vind je nog meer in eiwitten naast C, O, N en H?

STAP 5: Vergelijking van de sequenties van humaan en runder rhodopsine

Hieronder zie je een vergelijking van de aminozuurvolgordes van runder en humaan rhodopsine (een zogenaamde "alignment"). Sequentie alignments vormen het hart van de bioinformatica omdat ze het mogelijk maken om informatie over een bepaald eiwit over te dragen naar een ander eiwit (mits dat maar voldoende op het eerste eiwit lijkt).
Overal waar * staan zijn de aminozuren in beide eiwitten identiek.

runder MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY
humaan MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY
       *************** ********* **********************:***********

runder VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
humaan VTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLG
       ***************************:****:***************************

runder GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP
humaan GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIP
       ****************************************************.*******

runder EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES
humaan EGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQES
       **:********** : *.************** **:*:**********************

runder ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
humaan ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAI
       *************************:***.***********:**************::*:

runder YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA
humaan YNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA
       *****************:**:*************:*************



Vragen:

  1. Hoeveel van de 348 aminozuren die beide rhodopsines bevatten zijn er verschillend tussen mens en rund?
  2. Reken hiermee uit hoe groot het percentage sequentie overeenkomst is. (Voorbeeld: Als 40 aminozuren van de 348 zouden verschillen is het percentage overeenkomst (348-40)/348= 88.5%)
  3. Kun je bedenken wat de symbolen "." en ":" betekenen in de alignment?
Omdat het percentage identieke aminozuren tussen humaan en runder rhodopsine erg hoog is betekent dit dat ook de 3-dimensionale structuren sterk op elkaar lijken en we dus met behulp van de informatie die de runderstructuur ons biedt voorspellingen kunnen doen voor de structuur van het menselijk rhodopsine.

STAP 6: De plaats van de RP mutaties in de drie-dimensionale structuur van rhodopsine

In onderstaande structuur zijn de bovengenoemde aminozuren, die dus gemuteerd zijn in RPpatienten, duidelijk weergegeven.


Terug naar startstructuur!

Serine 186

Cysteine 187

Methionine 207

Alanine 292

Lysine 296

De retinal groep

Zoom in

Ruimtevullend model (van der Waals stralen)

red/cyan stereo aan uit

 

 

Vraag:

  1. Kun je nu bedenken waarom bij mensen met een of meerdere van deze mutaties in hun rhodopsine eiwit het proces van zien niet goed verloopt?

STAP 7: Eiwitdatabases

Nagenoeg alle eiwit sequenties die bepaald worden komen terecht in wereldwijde databanken die voor iedereen vrij doorzoekbaar zijn via Internet. Probeer de eiwitsequentie van het humane rhodopsine te vinden in de eiwitsequentie database SwissProt. Zie hiervoor de volgende aanwijzigingen


STAP 8/Tot slot: Webpagina's die je kunt gebruiken bij dit onderzoek

  1. Mutation Database: Mutations of the Rhodopsin Gene
  2. RetNet: Retinal Information Network
  3. Rhodopsine
  4. Retinal
  5. Erfelijk: wat is dat?